Glyma08g45520 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g45520

Feature Type:	gene_model
Chromosome:	Gm08
Start:	44876345
stop:	44877532
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g45520

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G17860	AT	Annotation by Michelle Graham. TAIR10: Kunitz family trypsin and protease inhibitor protein \| chr1:6149343-6149933 FORWARD LENGTH=196	SoyBase	E_val: 9.00E-19	ISS
GO:0006457	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein folding	SoyBase	N/A	ISS
GO:0009408	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to heat	SoyBase	N/A	ISS
GO:0009644	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to high light intensity	SoyBase	N/A	ISS
GO:0010167	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to nitrate	SoyBase	N/A	ISS
GO:0015706	GO-bp	Annotation by Michelle Graham. GO Biological Process: nitrate transport	SoyBase	N/A	ISS
GO:0034976	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress	SoyBase	N/A	ISS
GO:0042542	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
GO:0004866	GO-mf	Annotation by Michelle Graham. GO Molecular Function: endopeptidase inhibitor activity	SoyBase	N/A	ISS
PF00197	PFAM	Trypsin and protease inhibitor	JGI		ISS
UniRef100_C6T586	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T586_SOYBN	SoyBase	E_val: 7.00E-150	ISS
UniRef100_Q8W3K5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Mcp20 n=1 Tax=Matricaria chamomilla RepID=Q8W3K5_9ASTR	SoyBase	E_val: 1.00E-148	ISS

Expression Patterns of Glyma08g45520

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g45520 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g341400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g45520

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g45520

Limit To All Plant Sequences

>Glyma08g45520.1   sequence type=CDS   gene model=Glyma08g45520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGAGTACTACCTCTTTGGCTCTCTTTCTACTTTGTGCCCTAACTTCATCATATCAGCCTTCAGCCACCGCTGATATTGTATTCGACACCGAAGGCAATCCTATTCGAAACGGCGGCACATACTATGTGTTGCCAGTTATAAGAGGAAAGGGCGGCGGAATAGAATTTGCCAAAACCGAAACAGAAACATGCCCTCTCACTGTTGTGCAATCTCCCTTTGAGGTCTCAAAGGGTCTACCACTGATAATTTCATCCCCATTTAAAATCCTTGACATCACCGAAGGACTTATTTTGAGCCTCAGTTTCACTTATGTACCCCCCTGTGCCTCAACTCCTTCTCGGTGGACCGTTATTCTCAAGGGTCTGCCAGAAGAACTCCATGTCAAACTCACTGGCTACAAAAACACAATAGATGGTTGGTTTAGGATTCAAAGAGCTTCCTCTGAATCCAACTACTATAAGTTGGTGTTTTGTACATCTAATGATGATAGTTCGTGTGGGGATATTGTGGCTCCCATCGATCGTGAAGGAAACAGGCCTTTGATTGTGACTCATGATCAGAATCATCCATTGTTGGTTCAGTTTCAGAAAGTTGAAGCTTATGAATCATCAACTGCATGA

Predicted protein sequences of Glyma08g45520

Limit To All Plant Sequences

>Glyma08g45520.1   sequence type=predicted peptide   gene model=Glyma08g45520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKSTTSLALFLLCALTSSYQPSATADIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTETETCPLTVVQSPFEVSKGLPLIISSPFKILDITEGLILSLSFTYVPPCASTPSRWTVILKGLPEELHVKLTGYKNTIDGWFRIQRASSESNYYKLVFCTSNDDSSCGDIVAPIDREGNRPLIVTHDQNHPLLVQFQKVEAYESSTA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain